Resources Contact Us Home
Browse by: INVENTOR PATENT HOLDER PATENT NUMBER DATE
 
 
Inventor:
Labigne; Agnes
Address:
Bures-sur-Yvette, FR
No. of patents:
14
Patents:












Patent Number Title Of Patent Date Issued
7517666 Methods of inhibiting Helicobacter pylori April 14, 2009
This application relates to methods of screening molecules capable of inhibiting the survival of Helicobacter pylori in vivo by specifically inhibiting the activity of UreI, to the molecules identified by these methods, and to the use of these molecules to treat or prevent H. pylori
6899881 H. PYLORI FLBA POLYPEPTIDES, IMMUNOGENIC AND VACCINATING COMPOSITIONS COMPRISING H. PYLORI FLBA May 31, 2005
The present application relates to nucleotide sequences which regulate the biosynthesis of the flagella proteins Helicobacter pylori, to the proteins encoded by these sequences and to a aflagellate bacterial strains. The invention also relates to the use of these means for detecting an
6838273 Cloning and characterization of the FLBA gene of H. pylori, production of aflagellate strains January 4, 2005
The present application relates to nucleotide sequences which regulate the biosynthesis of the flagella proteins Helicobacter pylori, to the proteins encoded by these sequences and to aflagellate bacterial strains. The invention also relates to the use of these means for detecting an
6762051 Methods of inhibiting helicobacter pylori July 13, 2004
This invention relates to methods of screening molecules capable of inhibiting the survival of Helicobacter pylori in vivo by specifically inhibiting the activity of UreI, to the molecules identified by these methods, and to the use of these molecules to treat or prevent H. pylori in
6476213 Cloning and characterization of FLBA gene of H. pylori production of aflagellate November 5, 2002
The present application relates to nucleotide sequences which regulate the biosynthesis of the flagella proteins Helicobacter pylori, to the proteins encoded by these sequences and to aflagellate bacterial strains. The invention also relates to the use of these means for detecting an
6271017 Genes of Heliciobacter pylori necessary for the regulation and maturation of urease and their us August 7, 2001
Oligonucletodie sequences are disclosed specific to H. pylori urease and useful as DNA probes and primers in the detection of H. pylori infection in humans.
6258359 Immunogenic compositions against helicobacter infection, polypeptides for use in the composition July 10, 2001
There is provided an immunogenic composition capable of inducing protective antibodies against Helicobacter infection characterized in that it comprises:i) at least one sub-unit of a urease structural polypeptide from Helicobacter pylori (SEQ ID NO: 22,26), or a fragment thereof, said
6248330 Immunogenic compositions against helicobacter infection, polypeptides for use in the composition June 19, 2001
There is provided an immunogenic composition capable of inducing protective antibodies against Helicobacter infection characterized in that it comprises:i) at least one sub-unit of a urease structural polypeptide from Helicobacter pylori, or a fragment thereof, said fragment being recogn
6146634 Proteins with urease activity November 14, 2000
The invention relates more particularly to any nucleotide sequence corresponding, according to the universal genetic code, to at least one part of the following amino acid sequence (VIII) of 61 kDa (coded by the nucleotide sequence (VII)):1MKKISRKEYVSMYGPTTGDKVRLGDTDLIAEVEHDYTTYGEELKFGGG
6027878 Genes of Helicobacter pylori necessary for the regulation and maturation of urease and their use February 22, 2000
Oligonucleotide sequences are disclosed specific to H. pylori urease and useful as DNA probes and primers in the detection of H. pylori infection in humans. Also disclosed are methods of hybridization and amplification using these sequences.
5986051 Genes of Helicobacter pylori necessary for the regulation and maturation of urease and their use November 16, 1999
This invention relates to Helicobacter polypeptides, particularly UreE, UreF, UreG, UreH, and UreI, immunogenic fragments of those polypeptides, and compositions containing those polypeptides or fragments. This invention also relates to purified antibodies that bind to the polypeptid
5849295 Nucleotide sequences coding for a protein with urease activity December 15, 1998
The invention relates to a sequence of nucleotides, characterized in that it comprises at least a part of a sequence coding for a protein with urease activity such as that expressed by C. pylori.Another subject of the invention is the uses of this sequence, in particular for the in vitro
5837472 Nucleotide sequences coding for a protein with urease activity November 17, 1998
The invention relates to polypeptides possessing urease activity of the type expressed naturally in C. pylori and immunogenic compositions comprising those polypeptides. This invention also relates to antibodies to polypeptides possessing urease activity and use of those antibodies to
5695931 Nucleotide sequences coding for a protein with urease activity December 9, 1997
The invention relates to a sequence of nucleotides, characterized in that it comprises at least a part of a sequence coding for a protein with urease activity such as that expressed by C. pylori.Another subject of the invention is the use of this sequence, in particular for the in vitro










 
 
  Recently Added Patents
Information processing apparatus and display control method
Check weigher comprising of a rotating weighing chute with an accumulating and a discharge position that calculates flow rate by measuring weight accumulated during a predetermined time interv
Method and system for billing based on color component histograms
Predictive time entry for workforce management systems
Vehicle control system
Global codebook for coordinated multi-point processing
Semiconductor device
  Randomly Featured Patents
Slide out cargo floor
Chemical flooding with improved injectivity
Variable-attenuation tunable optical router
Process for the preparation of organopolysiloxane resin
Refurbishable aerial cargo delivery system and solid state circuit therefor
Method and apparatus for providing a hot docking interface for transmitting digital video data
Disease control in avian species by embryonal vaccination
Achromatic lens structure, method of fabrication, and imaging devices and systems using the same
Game animal escape impedance device
Adjusting method of battery pack and adjusting method of battery pack with controller