| Patent Number |
Title Of Patent |
Date Issued |
| 7100489 |
System and method for hitch with backup anti-jack knife and anti-dive |
September 5, 2006 |
| For use in landmine clearing, a hitch system providing backup with anti-jack knife and anti-dive, the system includes a hitch assembly and a roller assembly. The hitch assembly has a hinge axis housing containing a hinge shaft and a connector shaft housing containing a stop block having |
| 7096184 |
Calibrating audiometry stimuli |
August 22, 2006 |
| In one embodiment, a method is characterized by accepting voice input defining at least one spoken word; and calibrating the at least one spoken word in response to at least one defined speech-energy criterion. In one embodiment, a related system includes but is not limited to circui |
| 7095555 |
Multiple pass Faraday rotation amplifier |
August 22, 2006 |
| An apparatus for and a method of amplifying Faraday or Voigt rotation by passing light through a sample many times using multiple internal reflections and successive mirrored chambers that repeatedly send the light back through the sample. The sample is placed in a sample chamber tha |
| 7094883 |
Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein |
August 22, 2006 |
| A monoclonal antibody to a consensus peptide of the formula: VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described. The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO. 2) and has use as a diagnostic and for prophylaxis against |
| 7094417 |
Fish hatching method and apparatus |
August 22, 2006 |
| The invention is a method and kit for conducting a rapid toxicity test. Methods and kits according to the invention include an animal or plant species in diapause. |
| 7093909 |
Visual and thermal shield system |
August 22, 2006 |
| There is disclosed herein a visual and thermal shield system that effectively obscures visual indicators and thermal signatures of wheel assemblies of a military vehicle to thereby address longstanding military concerns for vehicle and crew survivability. Our device is spaced outboar |
| 7092106 |
System for determining the configuration of obscured structure by employing phase profilometry a |
August 15, 2006 |
| An application of phase profilometry to determine the 3-D configuration of normally obscured structure. In one application, the undercarriage of a vehicle is captured in a 3-D profile while the vehicle is operating normally. The system may use a digital camera; a computer for control, |
| 7090852 |
Venezuelan equine encephalitis virus replicon encoding marburg virus proteins |
August 15, 2006 |
| Using the MBGV GP, NP, and virion proteins, a method and composition for use in inducing an immune response which is protective against infection with MBGV in nonhuman primates is described. |
| 7089863 |
Non-Lethal cartridges with dense powder ballast |
August 15, 2006 |
| A non-lethal cartridge having sufficient discharge energy for use, without modification, in conventional firearms. When used with a firearm with a rifled barrel, the cartridge comprises a non-lethal projectile having a grooved outer surface and a dense powder ballast. Upon discharge, the |
| 7087235 |
Fusion protein of streptococcal pyrogenic exotoxins |
August 8, 2006 |
| The present invention relates to genetically attenuated superantigen toxin vaccines altered such that superantigen attributes are absent, however the superantigen is effectively recognized and an appropriate immune response is produced. The attenuated superantigen toxins are shown to |
| 7087186 |
Ferroelectric/paraelectric materials, and phase shifter devices, true time delay devices and the |
August 8, 2006 |
| Single-phase, non-cubic and single-phase, cubic ferroelectric/paraelectric perovskite-structured materials having reasonably low and fairly temperature insensitive dielectric constants (stable dielectric constants over a wide range of operating temperatures of -80.degree. C. to 100.d |
| 7086846 |
Electro spinning of submicron diameter polymer filaments |
August 8, 2006 |
| An electro spinning process yields uniform, nanometer diameter polymer filaments. A thread-forming polymer is extruded through an anodically biased die orifice and drawn through an anodically biased electrostatic field. A continuous polymer filament is collected on a grounded collect |
| 7084132 |
Artemisinins with improved stability and bioavailability for therapeutic drug development and ap |
August 1, 2006 |
| A stable form of artemisinin wherein an artelinic acid or artesunic acid is complexed with cyclodextrin analogs, preferably, .beta.-cyclodextrin. The complexed cyclodextrin artemisinin formulation shields the peroxide portion of the artemisinin backbone from hydrolytic decomposition |
| 7083140 |
Full-bore artillery projectile fin development device and method |
August 1, 2006 |
| A method and structure for a full-bore artillery projectile fin deployment device comprising a projectile stabilization fin comprising an aperture and a movable pawl; a rod comprising a head portion and a shaft portion terminating with a beveled tip configured for engaging the pawl; a |
| 7082001 |
Dual mode mirror imaging system |
July 25, 2006 |
| A dual mode mirror imaging system is described having a Cassegrain-type objective assembly having a primary mirror with a hole in its center and a secondary mirror spaced in front of the primary mirror, and imager optics disposed in the hole. The secondary mirror is adapted to receive |
| 7081529 |
Recombinant vaccine against botulinum neurotoxin |
July 25, 2006 |
| This invention is directed to preparation and expression of synthetic genes encoding polypeptides containing protective epitopes of botulinum neurotoxin (BoNT). The invention is also directed to production of immunogenic peptides encoded by the synthetic genes, as weel as recovery an |
| 7074318 |
Movable ionic conductive wire and method of forming an electrochemical cell |
July 11, 2006 |
| An ionic conductive wire and method of forming an electrochemical cell in which an electric insulate tube is filled with an ionic conductive material. Terminals proximate the ends of the electric insulate tube are sealed with a fine porous material that is electric-insulate. The ionic |
| 7071791 |
Automatic antenna-switching apparatus and system |
July 4, 2006 |
| An automatic antenna-switching apparatus is provided for the user to connect a single multiband communications platform to a group of antennas with different frequencies by detecting the RF energy input representing the user's selected frequency and automatically switching to the properl |
| 7069861 |
Micro-scale firetrain for ultra-miniature electro-mechanical safety and arming device |
July 4, 2006 |
| A microscale firetrain for a safe and arm device having a safe position and an armed position, the firetrain including an input explosive column having a longitudinal axis; a transfer charge having a longitudinal axis and first and second ends and movable from a safe position to an armed |
| 7069814 |
Apparatus for fastening a lid to a container |
July 4, 2006 |
| The present invention is a portable securing apparatus for fastening and unfastening a lid to a container. The apparatus minimizes or prevents health risks of medical conditions associated with repetitive and cumulative motions by minimizing or preventing repetitive motions performed |
| 7067964 |
Piezoelectric resonator with reduced deformation sensitivity |
June 27, 2006 |
| Reliable piezoelectric restraint mechanisms are provided that substantially reduce the ill effects of acceleration sensitivity through an increasingly rigid and precise orientation system. The piezoelectric resonator stress relief apparatus, devices and systems of the present inventi |
| 7062875 |
Barrel replacement or insert devices for firearm function conversion |
June 20, 2006 |
| An adapter device is provided for converting a grenade launcher into a weapon for firing shot shells. The adapter includes an elongate barrel member of a gauge for shot shell which is adapted to be received in, and extend through, the barrel of the host barrel assembly of the grenade |
| 7061604 |
Mortar projectile inspection apparatus and method |
June 13, 2006 |
| A structural member of a mortar projectile is inspected. The structural member is a composite structure having a thermoplastic matrix with a filler of steel balls. The composite structure has a central cavity into which is placed a strobe light. Surrounding the composite structure is a |
| 7061354 |
Strong quasi horseshoe magnet |
June 13, 2006 |
| A permanent magnet assembly, for engaging a generally planar surface of a ferromagnetic object to affix items of interest thereto, includes a shell of a magnetic material. The shell has a portion of either a magic sphere or a magic cylinder and a cavity and the shell terminates in a surf |
| 7061220 |
Passive radio frequency power spectrum analyzer |
June 13, 2006 |
| A spectrum analyzer includes a resonator board that in turn has a substrate and a plurality of resonators. Each resonator may include a first segment that includes a first segment discontinuity and that may also define a boundary and a second segment that has a second segment discont |
| 7060276 |
Plasmodium falciparum AMA-1 protein and uses thereof |
June 13, 2006 |
| In this application is described the expression and purification of a recombinant Plasmodium falciparum (3D7) AMA-1 ectodomain. The method of the present invention produces a highly purified protein which retains folding and disulfide bridging of the native molecule. The recombinant |
| 7060178 |
Universal single element filter test fixture |
June 13, 2006 |
| A filter-testing fixture holds a single fuel filter and is adjustable to accommodate a range of filter sizes and shapes. The fixture has a base section that defines a water collection reservoir, and the base opens upward toward a housing. Water separated from fuel in the housing thus |
| 7059251 |
Propelling charge support for a mortar cartridge |
June 13, 2006 |
| A propelling charge support comprises horseshoe-shaped clips for engaging the tail fin and holding the propelling charges together for protection, a rounded saddle for holding the propelling charges of the cartridge, and winged edges to protect the propelling charges and aid in removal o |
| 7059236 |
Apparatus and method for ballistic protection of vehicle undercarriages |
June 13, 2006 |
| An elongate ballistic protection apparatus is described and claimed herein which has minimal weight and maximum flexibility to conform to the most contorted and undulating ground surfaces. In use, it is immediately positioned below a military vehicle to protect the crew compartment p |
| 7058544 |
Knowledge-based condition survey inspection (KBCSI) framework and procedure |
June 6, 2006 |
| A knowledge-based condition survey inspection (KBSCI) framework and procedure for use with an engineering management system (EMS) that tailors types of condition survey inspections (CSIs) and inspection intervals to empirically-established life cycles of component-sections. Embodimen |
| 7056675 |
Method of forming an electrically conductive connection utilizing a polynucleotide/conductive po |
June 6, 2006 |
| A conductive polymer is formed enzymatically in the presence of a polynucleotide template. The method includes combining at least one redox monomer with a polynucleotide template and a redox enzyme, such as horseradish peroxidase, to form a reaction mixture. The monomer aligns along |
| 7055986 |
Programmable LED spectral light source |
June 6, 2006 |
| An apparatus for emulating various known night sky illumination conditions. The apparatus comprises a plurality of electrically-powerable LEDs which are disposed in an array and have respective spectral curves centered at different wavelengths in the visible to the short wave infrare |
| 7055438 |
System and method for a flameless tracer/marker utilizing heat marking chemicals |
June 6, 2006 |
| A flameless tracer/marker provides heat mark chemicals with optional chemlucents chemicals that can be carried and delivered by a projectile to mark a target. This marking payload may be carried by small, medium and large caliber projectiles that are part of ammunition items including |
| 7055437 |
Micro-scale firetrain for ultra-miniature electro-mechanical safety and arming device |
June 6, 2006 |
| A microscale firetrain for a safe and arm device having a safe position and an armed position, the firetrain including an input explosive column having a longitudinal axis; a transfer charge having a longitudinal axis and first and second ends and movable from a safe position to an armed |
| 7055422 |
Reduced recoil anti-armor gun |
June 6, 2006 |
| An improved Barrett anti-armor gun that is modified to function from the open bolt with advanced primer ignition, wherein the forward momentum of the recoiling masses at the moment of firing offset a significant portion of the recoil impulse from firing. The modification reduces the reco |
| 7055278 |
Portable tube cleaning system |
June 6, 2006 |
| A portable cannon tube cleaning system that includes a trailer designed to be pulled to the field site of a cannon tube to be cleaned; a mechanism securely mounted to the floor of the trailer for providing vertical height adjustment; a main cleaner chassis assembly securely mounted to |
| 7053523 |
Lateral field excitation of bulk acoustic waves from an IC-compliant low voltage source |
May 30, 2006 |
| An Interdigital Bulk Acoustic-Wave Transducer (IBAT) device is provided with pairs of exciting electrode fingers disposed sufficiently close together on the piezoelectric substrate and dielectric coating over the exciting electrode fingers to generate an IC-compatible voltage at rela |
| 7052848 |
Internal positive control for probe-based nucleic acid molecule assays and methods of making and |
May 30, 2006 |
| Disclosed herein are isolated nucleic acid molecules that may be used as an internal positive controls in probe-based nucleic acid assays such as TaqMan.RTM. based assays. Also disclosed are probes comprising the isolated nucleic acid molecule of the present invention. The probes may |
| 7052174 |
Device for determining changes in dimension due to temperature fluctuation |
May 30, 2006 |
| An apparatus for non-destructively testing the response of a specimen to temperature change. An embodiment temperature cycles a specimen, such as a wet mortar beam, dynamically measuring change in dimension and the temperature of the specimen during the cycle. Among other elements, the |
| 7051535 |
Turbine engine differential-pressure torque measurement system |
May 30, 2006 |
| Applicant's Differential-Pressure Torque Measurement System generates the torque signal from a differential gas pressure measured across the power turbine. The gas pressure differential is measured by using two pressure taps, the first tap taking the pressure reading of the expanding gas |
| 7050050 |
Method for as-needed, pseudo-random, computer-generated environments |
May 23, 2006 |
| A method for as-needed, pseudo-random, computer-generated environments. The as-needed step allows for that area of the environment actually in use to be instantiated only as needed and only for as long as it remains in use. The as-needed step allows for a potentially infinite environment |
| 7049085 |
Antibodies against type a botulinum neurotoxin |
May 23, 2006 |
| Antibodies for binding epitopes of BoNT/A and hybridomas which produce such antibodies are described. The antibodies of the present invention can be used in a method for detecting BoNT/A in a sample and/or in a method for purifying BoNT/A from an impure solution. In addition, the ant |
| 7046002 |
Magnetic sensor with variable sensitivity |
May 16, 2006 |
| A microelectromechanical system (MEMS) device comprising a base structure; a magnetic sensor attached to the base structure and operable for sensing a magnetic field and allowing for a continuous variation of an amplification of the magnetic field at a position at the magnetic sensor; |
| 7045336 |
Bacterial delivery system |
May 16, 2006 |
| We describe a bacterial delivery system for the delivery of DNA and antigens into cells. We constructed an attenuated bacterial vector which enters mammalian cells and ruptures delivering functional plasmid DNA and antigens into the cell cytoplasm. This Shigella vector was designed to |
| 7045091 |
Transient liquid phase reactive sintering of aluminum oxynitride (AlON) |
May 16, 2006 |
| A transparent aluminum oxynitride product is produced by a first heat treating step wherein a combination of Al.sub.2O.sub.3 and AlN at a temperature within the solid-liquid phase and a second step of sintering the heat treated combination at a temperature at least 50.degree. C. less |
| 7044060 |
Missile-borne explosive activated grenade release device |
May 16, 2006 |
| A delivery and release device for release and detonation of sequential explosive charges is disclosed to penetrate hardened structures. An aerodynamic shell is sized for delivery to a target by hand or mechanical means, including a first explosive charge is in a forward portion and a |
| 7043437 |
Standardized inpatient-outpatient nomenclatures and accepting both outpatient and inpatient data |
May 9, 2006 |
| Methods and systems which provide for standardized inpatient-outpatient nomenclatures and accepting both outpatient and inpatient data to commonly accessible storage. In a first method embodiment, the first method is characterized by accepting user input identifying at least two diff |
| 7042646 |
Infrared device having an optical power limiter with improved optical gain |
May 9, 2006 |
| An infrared device in accordance with the present invention includes an optical train for receiving incident radiation into the device, a focal plane array for receiving the incident radiation from the optical train, and an optical power limiter (OPL) that is positioned therebetween. To |
| 7040570 |
Weather-agile reconfigurable automatic target recognition system |
May 9, 2006 |
| Applicants' ATR system is weather-agile because it is comprised of a primary target sensing means that is capable of surveilling the target scene in foul or fair weather, and a secondary target sensing means that is also capable of sensing targets in various weather. The primary and |
| 7040211 |
Mortar bomb retention apparatus |
May 9, 2006 |
| A mortar bomb retention apparatus for retaining a mortar bomb in a mortar tube includes a lever arm; a lever positioner in which the lever arm is rotatably mounted; a generally cylindrical housing having a central opening therethrough, the central opening comprising a large diameter |
