| Patent Number |
Title Of Patent |
Date Issued |
| 7445753 |
Automated ampoule breaking device |
November 4, 2008 |
| An automated ampoule breaking device includes a carriage having an opening for receiving and securely retaining a substrate in a substantially upright position, wherein the substrate includes at least one flexible compartment each having an outlet at the lower end and at least one am |
| 7445299 |
Mine resistant band track |
November 4, 2008 |
| A band track for a tracked vehicle having enhanced resistance to mines includes a plurality of track pad units disposed on the bearing surface of the track band. The track pad units have extended end walls of sufficient height to distance the vulnerable portion of the band track from |
| 7442677 |
Activated peroxide solution with improved stability useful for the decontamination of chemical w |
October 28, 2008 |
| A chemical solution and process for the decontamination of chemical warfare agents. More particularly, a process for the decontamination of the vesicant HD by oxidation to its corresponding sulfoxide and nerve agents VX and GD by perhydrolysis to their non-toxic phosphonic acids usin |
| 7442471 |
Solvent systems comprising a mixture of lactams and esters for non-aqueous electrolytes and non- |
October 28, 2008 |
| A non-aqueous electrolyte solution for lithium or a lithium ion cell, which improves lithium ion cell capacity retention and enhances storage life thereof. The non-aqueous solution can be implemented in the context of an electrolyte system that includes a lithium salt dissolved in a |
| 7442237 |
Multi-agent end-of-service-life indicator for respirator filters |
October 28, 2008 |
| An end-of-service-life-indicator for a multi-agent respirator filter that is safe, reliable, and easy to read and may be configured to cover a broad range of threats, including chemical warfare agents and toxic industrial chemicals, is achieved by positioning an array of chemically r |
| 7442137 |
Eccentric mounting and adjustment system for belt driven devices |
October 28, 2008 |
| An eccentric adjustment and mounting system is useful for belt engaging engine components such as alternators or water pumps. The system includes a housing fixed to the engine, a socket rotatable in pawl-and-ratchet fashion within the housing, and a socket aperture eccentrically disposed |
| 7441793 |
Tow hitch lunette assembly |
October 28, 2008 |
| For use in a vehicular trailer hitch system, a vehicular trailer hitch lunette assembly is provided. The assembly includes at least one "U" shaped outer laminate plate having two legs with a semi-circular region therebetween, and at least one substantially flat inner laminate plate p |
| 7441489 |
Mortar bomb positioning apparatus |
October 28, 2008 |
| A mortar munition includes a mortar tube; first and second openings in the wall of the mortar tube, the first opening being closer to a breech end of the mortar tube than the second opening; a spring loaded valve assembly disposed in the first opening in the wall of the mortar tube; |
| 7440102 |
Systems and methods for analyzing polarized light scattered from a sample |
October 21, 2008 |
| Systems for analyzing polarized light back-scattered from a sample are provided. An exemplary system comprises an optical beamsplitter, a polarization separator and an array of light detectors. The optical beamsplitter is operative to receive an incident ray of light, to direct at le |
| 7437972 |
Apparatus for fastening and loosening a lid from a container |
October 21, 2008 |
| The device performs the function of opening and/or closing lids attached to containers, and more particularly child-proof lids in at least some embodiments. The device preferably includes a base, a post, a lever, a plate to engage the lid of a container, and a mechanism that coverts |
| 7428782 |
Plotting board with magnetic pivot |
September 30, 2008 |
| A plotting board includes a base; a top; a pivot that connects the top and the base, the top and the base being rotatable and detachable with respect to each other, the pivot including a magnet wherein at least a portion of the pivot is disposed at a substantially central point on the |
| 7428252 |
Unstable monoblock laser cavity with integrated beam expander |
September 23, 2008 |
| A monoblock laser cavity includes a plurality of discrete optical components disposed serially on a substrate and sharing a common optical axis. The optical components include a laser rod of gain material, a Q-switch, an OPO crystal, an output coupler, and a positive lens. The output |
| 7426156 |
Method and apparatus for clock synchronization that accounts for curvature in the space-time con |
September 16, 2008 |
| Methods and apparatuses for applying a correction that accounts for curvature in the space-time continuum in the context of clock synchronization are disclosed. A representative apparatus, among others, includes a memory having a curved space-time correction module and a processor. T |
| 7425705 |
Thermoluminescent reader system |
September 16, 2008 |
| A TLD reader system has a laser diode that heats a thermoluminescent material causing a hemispherical photon emission that is collected by a ball lens. A filter ensures the ball lens receives and collects a predetermined transmittance value of the photons emitted within a predetermin |
| 7422102 |
Container for ammunition |
September 9, 2008 |
| A container for an ammunition cartridge having a conical forward portion includes a generally cylindrical cap having a closed end and an open end; a generally cylindrical main body having a closed end, an open end and a wall, a thickness of the wall at the open end decreasing from a larg |
| 7421934 |
Mortar tube for training |
September 9, 2008 |
| A training mortar apparatus includes a small mortar tube and a large mortar tube, the small mortar tube being disposed in the large mortar tube; a removable base cap attached to one end of the small mortar tube; a plug inserted in the removable base cap; a removable firing pin insert |
| 7420318 |
Lateral piezoelectric microelectromechanical system (MEMS) actuation and sensing device |
September 2, 2008 |
| A microelectromechanical system (MEMS) device comprises a substrate; an anchored end connected to the substrate; a free end comprising an end effector opposite to the anchored end; a spring attached to the end effector; multiple actuation beams; multiple connection beams adapted to c |
| 7419327 |
Method for fabricating and employing a paving system using arrays of vertically interlocking pav |
September 2, 2008 |
| A method for fabricating and forming a continuous covered area, such as a sidewalk or patio, employing vertically interlocking tessellated components. One embodiment, termed PORTAPAVE.TM., achieves this interlocking via an array of uniquely configured two-sectioned pavers. Each paver |
| 7419122 |
Combined skirt-reefing and slider method for controlled parachute opening |
September 2, 2008 |
| A parachute system having a parachute canopy having a skirt, and a plurality of gores spaced about the skirt. The plurality of gores is defined by first and second groups of gores. The parachute system includes a slider having a plurality of through-holes, a line loop attached to the |
| 7418906 |
Dual spin canister ammunition |
September 2, 2008 |
| A dual spin projectile includes a base; a body connected to the base with a first snap joint, the first snap joint allowing relative rotation between the base and the body; a can having an open forward end and connected to the body with a second snap joint, the second snap joint allo |
| 7418896 |
Recoilless weapon system |
September 2, 2008 |
| A recoilless weapon system is provided rear portion, a barrel in movable connection to the rear portion, and a handle portion in removable connection with the barrel and/or rear portion. Further, a ballast payload cartridge is removably disposed within a ballast payload cartridge por |
| 7416878 |
Immunogenic compositions including rough phenotype Brucella host strains and complementation DNA |
August 26, 2008 |
| Live attenuated vaccines against brucellosis and infection by other diseases are described. It has been discovered that trans complementation of the Brucella wboA gene can be used to maintain an expression vector in an attenuated Brucella host cell in a vaccinee. Further, heterologous |
| 7416158 |
Continuous disreefing apparatus for parachute |
August 26, 2008 |
| A continuous disreefing apparatus has a sleeve that has a diameter and is made from a flexible, resilient material that allows the sleeve to diametrically contract when the sleeve is under tension and to diametrically relax when such tension is substantially reduced or removed. The s |
| 7416154 |
Trajectory correction kit |
August 26, 2008 |
| The Trajectory Correction Kit (TCK) is a completely self-contained retrofit kit that is externally and fixedly mounted as an add-on to the rear (aft of the tailfins) of an existing, unguided rocket. The TCK continuously measures the pitch and yaw of the rocket as it is released from |
| 7415929 |
Systems with bore-launched projectiles |
August 26, 2008 |
| Systems for launching one or more projectiles from a bore are provided. An exemplary system incorporates a shell, a projectile, an explosive charge and a wad. The shell includes a base and a casing, with the casing defining an interior. The projectile is located within the interior and |
| 7415864 |
Orifice test device for protective mask testers |
August 26, 2008 |
| An orifice test calibration device tests the functionality of protective mask testers. The orifice test calibration device has a semi-rigid tubular channel with one end for sealing the flow outlet port of the protective mask tester and a second end for sealing the vacuum inlet port o |
| 7412144 |
Photonic crystal-based optical waveguide modulator |
August 12, 2008 |
| A waveguide has upper and lower cladding regions. A core of the waveguide made of a non-linear optical polymer is positioned between the upper and lower cladding regions. A first electrode is connected to the upper cladding region and a second electrode is connected to the lower cladding |
| 7412020 |
Training for time-selective wireless fading channels using cutoff rate |
August 12, 2008 |
| The optimal allocation of resources--power and bandwidth--between training and data transmissions is considered for time-selective Rayleigh flat-fading channels under the cutoff rate criterion. The transmitter, assumed to have statistical channel state information (CSI) in the form o |
| 7411662 |
Systems and methods for performing active LADAR and passive high resolution imagery |
August 12, 2008 |
| A system and method for performing high-resolution imagery of a target are provided. One embodiment is a method of performing high-resolution imagery of a target comprising: generating a chirped waveform that modulates a light signal transmitted toward a target for performing active |
| 7411401 |
Systems and methods for reducing common-mode platform noise in electric-field sensors |
August 12, 2008 |
| Systems and methods for reducing electrostatic platform noise in electric-field sensors due to various self-charging and discharging processes are provided. A representative method includes: identifying avoidance regions of an electrostatically-floating sensor platform that have a pr |
| 7410063 |
Method and system for sorting particles sampled from air |
August 12, 2008 |
| Methods and systems for sorting particles entrained in a gaseous stream are disclosed. A representative system, among others, includes a particle scanner, a sorter, which is in pneumatic communication with the particle scanner, and a controller, which is in electrical communication with |
| 7409374 |
Explosive event discrimination method |
August 5, 2008 |
| A method for discriminating between explosive events having their origins in High Explosive or Chemical/Biological detonation employing multiresolution analysis provided by a discrete wavelet transform. Original signatures of explosive events are broken down into subband components t |
| 7409116 |
RF to optical converter for RF imaging with optical sensors |
August 5, 2008 |
| A radio frequency (RF) to optical converter for RF imaging, wherein the converter comprises an array of RF antenna pixels adapted to receive RF signals, wherein the RF antenna pixels are adapted to facilitate RF resonance of the received RF signals; a photonic band gap (PBG) layer co |
| 7408653 |
Shim dialer platform and process to compensate for optical variations in components used in the |
August 5, 2008 |
| A through-optical bench is the optical equivalent of a folded-optical system. Folded optics is generally found in cannon launched guided projectiles and always includes a mirror mounted on a gimbal. Inside the projectile the optical image is hidden behind the mirror and is not easily |
| 7407935 |
Ricin toxin A-chain fragment for use as a vaccine |
August 5, 2008 |
| Disclosed herein are polypeptides and variants thereof comprising a polypeptide sequence having substantial identity to ricin A chain (RTA) that lack detectable N-glycosidase-rRNA activity or exhibit reduced N-glycosidase-rRNA activity as compared to controls and methods of making an |
| 7407638 |
On-demand lead azide production |
August 5, 2008 |
| The present invention discloses a process for the on-demand production of small quantities of lead azide. First, a metered quantity of sodium azide solution and a metered quantity of a solution of a lead salt sufficient to react with the sodium azide are introduced into a T-mixer or Y-mi |
| 7406908 |
Method of making a one-piece loop for ammunition cartridge |
August 5, 2008 |
| A one-piece metal cartridge loop has no welds and no overlapping parts. The cartridge loop includes a plurality of locking tabs for positioning a cartridge therein. One end of the cartridge loop includes a coupling interface and another end of the cartridge loop includes a coupling s |
| 7406907 |
Coupling for connecting ammunition cartridge loops |
August 5, 2008 |
| An apparatus comprising a cartridge loop, the cartridge loop having a coupling interface with an opening defined in part by a pair of substantially parallel lines separated by a distance; and a coupling comprising first and second ends and a link that connects the first and second en |
| 7404961 |
Peptides responsive to antibodies against consensus peptide of the CS4-CFA/I family proteins |
July 29, 2008 |
| This invention relates to amino acid sequences from within a consensus peptide of the formula: TABLE-US-00001 VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID. NO: 1) Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. |
| 7404358 |
Smoke producing mortar cartridge |
July 29, 2008 |
| A mortar cartridge generates effective white or colored smoke obscuration with reduced adverse environmental impact and collateral damage and provides an improved drag assembly that reduces drift during projectile descent and improves targeting. |
| 7401007 |
Method, computer program and apparatus for extracting large size signal data samples with an aut |
July 15, 2008 |
| A method for rapidly extracting data file samples with an a signal monitor and an automatically adjusted decimation ratio is provided to solve the long-standing problems caused by large data files and small buffers by reducing a large data segment to a smaller, more manageable size a |
| 7399534 |
Structures producing a magnetic field with a gradient and a cylindrical magnetic field source |
July 15, 2008 |
| Magnetic field structures composed of nested cylindrical magnetic laminae that are magnetically oriented perpendicular to their planes and configured to cause a volume charge density and cancel the field effects of unwanted surface negative charges are provided by arranging nested th |
| 7397165 |
Surface wave resonator with reduced acceleration sensitivity |
July 8, 2008 |
| A restrained surface wave resonator with reduced or abated acceleration sensitivity is provided with a stiffening layer, adhesive layers and subsurface horizontal indentations on the substrate to achieve reduced acceleration sensitivity, increased structural rigidity, decreased sensi |
| 7395922 |
Container for grenades |
July 8, 2008 |
| A grenade container includes a box having a bottom and four sides; a first foam layer disposed on the bottom of the box; a second foam layer disposed on the first foam layer and having a plurality of openings formed therein for receiving grenades; a plurality of grenades placed in th |
| 7395761 |
Variable-force payload ejecting system |
July 8, 2008 |
| The Variable-Force Payload Ejecting System, residing within an air vehicle, utilizes multiple pressure generators, one or more of which may be activated, to produce variable levels of force. A controlling computer within the air vehicle determines when and how much pressure needs to be |
| 7393694 |
Chemical and biological sampling device and kit and method of use thereof |
July 1, 2008 |
| A self-contained, leak-proof sampling device and kit employing said device for collecting chemical and biological samples from various surfaces. The invention provides a sampling device and kit that may be employed to easily collect chemical and biological samples, safely transport the |
| 7393045 |
Two-piece armored cab system |
July 1, 2008 |
| A system for a two-piece armored cab includes an upper cab portion, a lower cab portion, and a vehicle chassis system. The upper cab portion and the lower cab portion are armored to provide protection to occupants of the cab system. The upper cab portion removably mates to the lower cab |
| 7381937 |
Image analysis and enhancement system |
June 3, 2008 |
| An image analysis and enhancement system is provided with an image processor, imaging metrics, an image storage depository, and a reconfigurable sensor device that can be present at the same location. A remote reconfigurable sensor device is connected to the image processor via a com |
| 7380548 |
Stove apparatus |
June 3, 2008 |
| A stove comprising a frame bounding an area to receive a burner, a heating cavity assembly mounted on the frame and having four side walls and a bottom wall having an opening therein, and a collar mounted in the heating cavity assembly around the opening. Front, rear, and side panels |
| 7380488 |
Blank firing adapter for combination gas and recoil operated weapon |
June 3, 2008 |
| A firing adapter for a combination gas and recoil operated weapon includes a blank firing barrel attached to the weapon; a piston having a barrel end and an anchor end, the barrel end being reciprocably disposed in the blank firing barrel and the anchor end being fixed to a non-recoil |
