| Patent Number |
Title Of Patent |
Date Issued |
| 7581484 |
Weapon system retention device |
September 1, 2009 |
| An apparatus for retaining an object in a gun tube of a weapon system, the gun tube having a longitudinal axis, a chamber and a breech ring with an opening therein, the apparatus including a plunger that reciprocates in the opening in the breech ring and the chamber; a housing fixed in t |
| 7581482 |
Supersonic turning vane |
September 1, 2009 |
| A supersonic turning vane includes a suction side and a pressure side; the suction side including an expansion turning wall wherein the expansion turning wall creates an expansion fan that projects into the supersonic flow passage to turn supersonic flow into the turning vane; the pressu |
| 7580604 |
Zero index material omnireflectors and waveguides |
August 25, 2009 |
| We have shown that a single layer of a 3D Zero Index Material (ZIM) has omnidirectional reflection properties. In the range between the electric plasma frequency and the magnetic plasma frequency, ZIM reflect radiation for all angles of incidence and polarization with reflectivities of |
| 7578895 |
Perchlorate free flash bang compositions for pyrotechnic training rounds |
August 25, 2009 |
| A perchlorate-free solid pyrotechnic flash bang composition is disclosed, which comprises an oxidizer component selected from the group comprising potassium nitrate, strontium nitrate, and basic copper nitrate and combinations thereof, a metallic fuel component selected from the group |
| 7578480 |
Reefing apparatus for controlling the inflation of a gliding wing parachute |
August 25, 2009 |
| A reefing apparatus for controlling inflation of a gliding wing parachute which has a generally rectangular or trapezoidal canopy with four outer corners. The reefing mechanism includes a primary reefing loop with four supplemental reefing loops movably secured thereto by loops and conne |
| 7578238 |
Base bleed boat tail converter for projectile |
August 25, 2009 |
| A projectile may be used in a boat tail or base bleed configuration. The projectile includes a warhead casing having a nose end and a base end; a payload disposed in the warhead casing; a motor body attached to the base end of the warhead casing and having an igniter disposed therein; a |
| 7578227 |
Fire control mechanism for selectable fire |
August 25, 2009 |
| A fire control mechanism provides semi-automatic, burst, fully automatic, and safe modes for a firearm. The fire control mechanism includes first, second and third shafts. A hammer is rotatably mounted on the first shaft and biased for rotation about the first shaft in a first direction. |
| 7576837 |
Micro-mirror optical tracking and ranging system |
August 18, 2009 |
| A micro-mirror optical tracking and ranging system comprises an optical transceiver having a Micro-Electro-Optical Mechanical System (MEOMS) micro-mirror beam steering system and an electronic control and operating system for processing electronic signals. An optical transceiver and |
| 7576791 |
Method and apparatus for signature reduction using wavefront coding |
August 18, 2009 |
| The invention applies wavefront coding to the front of an electro-optic/infrared device to minimize the amount of light which is retroreflected by systems, such as Fowarding Looking Infrared systems, back to its source. The invention (unlike conventional reduction methods) does not r |
| 7574340 |
Small molecules and a pharmacophore model for inhibition of botulinum toxin and methods of makin |
August 11, 2009 |
| Disclosed herein is a pharmacophore model for inhibiting Botulinum neurotoxin A metalloprotease activity which comprises a first plane A, a second plane B, a first hydrophobic moiety C, a second hydrophobic moiety D and a positive ionizable substituent E. The pharmacophore model may |
| 7573564 |
Systems for doppler tracking using photonic mixing detectors |
August 11, 2009 |
| Ladar systems are provided. An exemplary ladar system includes a waveform generator for generating an arbitrary waveform, a laser for transmitting a modulated light signal toward a target, and a Doppler tracking loop for tracking the Doppler frequency shift between the transmitted light |
| 7571912 |
Bullet trapping medium, system for employing said medium and method of use of said medium |
August 11, 2009 |
| A stable fire retardant mixture for use in a backstop for decelerating and trapping projectiles. The backstop generally includes a support structure having an inclined surface and the stable fire retardant mixture serving as a projectile trapping medium disposed on the inclined surface. |
| 7570347 |
Chirped amplitude modulation ladar |
August 4, 2009 |
| An imaging method and apparatus using an unmodulated pulsed laser with a chirp modulated receiver is provided for producing 3D plus intensity imagery of targets in heavily cluttered locations The apparatus includes a laser for emitting a laser beam and synchronizing a receiver to receive |
| 7568433 |
Aerodynamically stable finless projectile |
August 4, 2009 |
| A finless projectile provides improved ease of use, aerodynamics, muzzle velocity, drag, target, and excursion accuracy, structural integrity, terminal effectiveness and safety, at lower cost. The finless projectile includes a slug, a forward projectile body, an aft projectile body, an |
| 7567391 |
Radiation source with self-aligning optics |
July 28, 2009 |
| A radiation source has a radiation-emitter assembly disposed, at least in part, in a first compartment of a housing. A lens system is disposed in a second compartment of the housing so that the lens system is optically coupled to the radiation-emitter assembly. A mirror is disposed in a |
| 7566540 |
Monoclonal antibody which agglutinates E. coli having the CS4-CFA/I family protein |
July 28, 2009 |
| A monoclonal antibody to a consensus peptide of the formula: TABLE-US-00001 VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. (SEQ ID NO:1) The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO:2) and has use as a diagnostic and for prophylaxis agains |
| 7566465 |
Artemisinins in the clinical and veterinary management of kinetoplastid infections |
July 28, 2009 |
| The invention relates to the treatment of kintoplastid infections by administering a pharmaceutical composition containing an extract from the plant Artemisia annua. The invention also relates to isolated, semi-synthetic and synthetic artemisinins that show improved efficacy in treat |
| 7563883 |
Recombinant P. falciparum merozoite protein-1.sub.42 vaccine |
July 21, 2009 |
| In this application is described the expression and purification of a recombinant Plasmodium falciparum (FVO) MSP-1.sub.42. The method of the present invention produces a highly purified protein that retains folding and disulfide bridging of the native molecule. The recombinant MSP-1 |
| 7560520 |
Interface-directed branched polymer transports and methods for producing same |
July 14, 2009 |
| Methods and systems for modifying a polymer are disclosed herein. A matrix is generally provided having a surface thereof, wherein the matrix comprises a plurality of hyperbranched polymers. The plurality of hyperbranched polymers can be chemically bound to a plurality of surfactants |
| 7557734 |
Airborne visibility indicator system and method |
July 7, 2009 |
| A system for providing an objective visibility measurement to a flight crew preferably includes a LIDAR system (100), an evaluation unit (150), and a crew interface (200). In at least one embodiment, the system includes the capability of compensating for aircraft turns such that the |
| 7554244 |
Agile tunable piezoelectric solidly-mounted resonator |
June 30, 2009 |
| Though the initial concept of the face-mounted resonator was ahead of fabrication technology, the solidly-mounted resonator (SMR) is now a practical resonator design yielding high Qs in a space-efficient and robust mounting configuration. An agile tunable piezoelectric SMR is now pro |
| 7552892 |
Dual-sliding fin lock assembly |
June 30, 2009 |
| The Dual-Sliding Fin Lock Assembly provides a simple, cost-effective and secure locking mechanism that engages on the initial opening stroke of a fin of a flying object, using a minimal number of parts that are easy to manufacture. Two sliding locks, each having a protruding step, engage |
| 7552729 |
Intubation device and method |
June 30, 2009 |
| In one embodiment, an apparatus is characterized by an intubation-tube placement device; and an intubation tube secured to the intubation-tube placement device. In another embodiment, an apparatus is characterized by an intubation-tube placement device; and an anti-perforation device |
| 7549376 |
Non-lethal projectile carrier |
June 23, 2009 |
| A non-lethal projectile carrier includes a base having a plurality of hinges, each hinge including a tab; and a payload case attached to the base, the payload case comprising a plurality of petaloid members, each petaloid member including an opening in a rear surface for insertion of a |
| 7549077 |
Automated self-forming, self-healing configuration permitting substitution of software agents to |
June 16, 2009 |
| A configuration for use with a processor that incorporates a suite of "flat" hardware architecture and superimposes thereon a self-forming, self-healing, hierarchical architecture implemented in software. Embodiments may be employed in various applications, such as maintaining networ |
| 7546917 |
Pallet adapter and detonation barrier for ammunition |
June 16, 2009 |
| An apparatus for packing containers includes a generally rectangular pallet adapter comprising rows and columns of cups, the rows and columns of cups being substantially orthogonal to each other, each cup comprising a lower portion that is generally circular and an upper portion that is |
| 7546806 |
Selectable output well perforator and method for producing variable hole profiles |
June 16, 2009 |
| Various shaped charges and methods of operation produce multiple jets in various profiles by employing multiple initiation points to address various earthen formations and producing different types of perforations in well bores. The shaped charge device includes a configuration of co |
| 7546804 |
Artillery charge with laser ignition |
June 16, 2009 |
| An artillery charge includes a generally cylindrical body with a hollow core; propellant disposed in the body and first energetic material disposed in the hollow core; and a seal disposed over one end of the hollow core, the seal including second energetic material disposed therein. |
| 7546759 |
Chemical/biological hose test adapter |
June 16, 2009 |
| The invention relates to devices and methods for adapting a standard protective mask test apparatus to perform leak testing of a mask air hose assembly as an independent equipment component, i.e., independent of the mask-hose system. |
| 7543534 |
Land mine, and hand thrown, weapon which dispenses marking chemicals |
June 9, 2009 |
| Described are flameless tracer munitions that are expelled from land mines or in hand thrown devices, which are used to mark an enemy person, vehicle body, or tires on the vehicle, with materials that emit infrared (IR) light, or heat emitting materials, or with a visible ink or a dye. |
| 7543524 |
Machine gun mount |
June 9, 2009 |
| A machine gun mount for attachment to a movable support arm of a helicopter and for holding a machine gun, the machine gun mount comprising a pintle that is rotatably connected at a first end to the movable support arm, the first end of the pintle providing for rotation of the machin |
| 7538800 |
Methods and apparatus for assessing visibility through an optical material |
May 26, 2009 |
| Assessing visibility through an optical material by capturing a digital image of a target through the material, determining its intensity, and using such intensity to determine a visual acuity index for the material. An apparatus for performing the method can assess visibility through an |
| 7537648 |
Filter service life estimator |
May 26, 2009 |
| A mechanical device is used to estimate a service life of an air filter exposed to a certain chemical at various concentrations, flow rates, and relative humidity conditions. The device includes two members, one of which has at least one window, connected so that their surfaces are m |
| 7536898 |
Quantitative aerosol dilution system |
May 26, 2009 |
| An inlet conduit (32) connects to aerosol source (100) of an initial particle concentration. A first flow path having particle counter (62) connects to inlet conduit (32). A second flow path (36) connects to the inlet conduit (32) and branches to form third flow path (38) and fourth |
| 7536821 |
Cartridge casing catcher with reduced firearm ejection port flash and noise |
May 26, 2009 |
| A catcher, in combination with a firearm having an ejection port, for receiving and retaining expended magnetically attracted shell casings through the ejection port as the firearm is discharged. The catcher includes a hollow housing having a plurality of rigid walls, and retainers. |
| 7536012 |
Entangled quantum communications and quantum imaging |
May 19, 2009 |
| An apparatus for generating a shared quantum key between a sender and a receiver comprises a sending apparatus which generates entangled photon pairs, and a receiving apparatus. A shared quantum key can be generated using temporal coincidences between photon detection events. For example |
| 7535617 |
Portable acousto-optical spectrometers |
May 19, 2009 |
| A portable acousto-optical (AO) spectrometer system comprised of at least one AO crystal cell device specially designed for cancellation of side-lobe noise at a desired tuned wavelength of operation. Each AO crystal cell device has a transducer attached and forms an AO tunable filter |
| 7533786 |
Personal water and additive apparatus |
May 19, 2009 |
| A personal water and additive apparatus includes a first container; a manifold having a water passageway and an additive passageway, the water passageway and additive passageway intersecting to form a single mixing passageway; a first tube connecting the first container to the water |
| 7533612 |
Projectile height of burst determination method and system |
May 19, 2009 |
| A method and system optimally determines a desired Height of Burst (HOB) over a target based solely upon the time at which the projectile reached or passes through the apogee or apex of its trajectory (t.sub.a). There are several modes of implementation. According to one mode, the downle |
| 7533483 |
Composite magazine for chambering ammunition in a firearm |
May 19, 2009 |
| An improved magazine for use in existing firearms comprises a housing, a follower, a spring, a spring hold and a cap. The housing comprises protruded surfaces for structural strength and a projection that acts as a stop member to define the maximum insertion of the magazine into the |
| 7532093 |
RF MEMS series switch using piezoelectric actuation and method of fabrication |
May 12, 2009 |
| A microelectromechanical system (MEMS) switch comprising a radio frequency (RF) transmission line; a structurally discontinuous RF conductor adjacent to the RF transmission line; a pair of cantilevered piezoelectric actuators flanking the RF conductor; a contact pad connected to the |
| 7529154 |
Hybrid thin film heterostructure modular vibration control apparatus and methods for fabrication |
May 5, 2009 |
| Microelectromechanical systems (MEMS) include critical devices for various highly sensitive applications. However, MEMS operation may be impaired by vibration. A modular vibration control pedestal for integration with a MEMS is provided according to embodiments of the present invention w |
| 7529075 |
Systems and methods involving electric-field cages |
May 5, 2009 |
| A representative system for providing an electric field comprises an electrically insulated frame, guard members and endplates. The frame incorporates a top, a bottom, opposing sides and opposing ends, with the sides extending between the top and the bottom. Each of the ends engages |
| 7527802 |
Vaccine for transcutaneous immunization |
May 5, 2009 |
| A vaccine delivered by transcutaneous immunization provides an effective treatment against infections by pathogens such as, for example, enterotoxigenic Escherichia coli (ETEC) and/or for symptoms of diarrheal disease caused thereby. For example, one, two, three, four, five or more a |
| 7526949 |
High resolution coherent dual-tip scanning probe microscope |
May 5, 2009 |
| A high-resolution scanning probe microscope using a coherent dual-tip probe comprises two single-atom protrusions on a single crystal metal wire. As the dual-tip probe scans across the surface of a sample material under an electrical bias, an interferenced electron wave function formed |
| 7525735 |
High resolution head mounted projection display |
April 28, 2009 |
| An exemplary embodiment of the invention relates to an on-axis or near on-axis optical head mounted projection display optical assembly for transmitting and magnifying a real image to an eye. The assembly comprises a miniature display, a projection lens for receiving the light rays f |
| 7524909 |
Fatty acid monomers to reduce emissions and toughen polymers |
April 28, 2009 |
| Novel fatty acid monomers and methods for their synthesis are provided for use in polymerization reactions. Fatty acid monomers are employed as reactive diluents in the polymerization of vinyl esters and polyesters for one or more purposes selected from improving the fracture resistance, |
| 7524794 |
Method for surface treating perlite sorbents for improved adsorbing of vapor phase metals and me |
April 28, 2009 |
| Perlite, particularly, perlite in powdered form, is employed to adsorb metals and metal compounds from a fluid flow. In select embodiments, the perlite is treated to expand its surface area and injected into a fluid stream, such as flue gas, held for a specific retention period, and |
| 7524579 |
Non-aqueous solvent electrolyte battery with additive alkali metal salt of a mixed anhydride com |
April 28, 2009 |
| A method for enhancing the performance characteristics of a battery through the use of the electrolyte composition comprised of a non-aqueous solvent, and a salt mixture. The salt mixture includes an alkali metal electrolyte salt and an additive salt having an anion of a mixed anhydr |
| 7518097 |
Reconfigurable imaging system |
April 14, 2009 |
| An image analysis and enhancement system is provided with an image processor, imaging metrics, an image storage depository, and a reconfigurable sensor device that can be present at the same location. A remote reconfigurable sensor device is connected to the image processor via a com |
